PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_003668-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family HB-other
Protein Properties Length: 347aa    MW: 39467.1 Da    PI: 4.4403
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_003668-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81e-09278325653
                    S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
       Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                    +++k q+e+Le+++ +++ p+ +++  + + ++L+ r+V  WF  +Ra
  NNU_003668-RA 278 RLKKVQIETLERVYSRTKRPTNAMISSIVHVTNLPRRRVLQWFEDKRA 325
                    57899******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.701270330IPR001356Homeobox domain
SuperFamilySSF466898.13E-10272332IPR009057Homeodomain-like
CDDcd000863.55E-7276325No hitNo description
SMARTSM003892.1E-4276334IPR001356Homeobox domain
PfamPF000463.0E-7278325IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.4E-9278326IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MAAASSSSSV VFWGSAASRH SDRLFVGRLA PPSPYVVVPR APFNCSTLVF SRRRRNSSSA  60
VTSSTTEKMK KKNKKLILPE NDDGEEEDID EDAFEALFRQ LEEDLKNDDL SVDDSDDEIS  120
EEDLAKLEQE LEEALGDDEL SGMFDSTTDA TKNDMESEEE EEEEEEEEEE EEEELKLKNW  180
QLRRLASALK DGRRKTRIKS LAAELCLDRA VVLELLRDPP PNLLLMCASL PDKVVPTSLP  240
ETKPMDPSEG TEIDAAEPEP KVKMPVHVMQ TRWSMQKRLK KVQIETLERV YSRTKRPTNA  300
MISSIVHVTN LPRRRVLQWF EDKRAEDGVP DHRLPYQRSA ADTVFTS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010250031.10.0PREDICTED: retrotransposon-like protein 1
RefseqXP_010250032.10.0PREDICTED: retrotransposon-like protein 1
SwissprotQ8H0V56e-80OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLF6H3091e-130F6H309_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g05190.t011e-129(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-71overexpressor of cationic peroxidase 3